PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00081714001
Common NameGSBRNA2T00081714001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 248aa    MW: 27976.1 Da    PI: 9.2491
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00081714001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-322477255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtpeLH++Fv+av+ LGG+ kAtPk +l++m+vkgLt++hvkSHLQ+YR 
  GSBRNA2T00081714001 24 PRLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDVKGLTISHVKSHLQMYRG 77
                         8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.1362080IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-292077IPR009057Homeodomain-like
SuperFamilySSF466893.05E-152476IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-222476IPR006447Myb domain, plants
PfamPF002497.4E-82576IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGKCGRSSDG GISGVRPYVR SPVPRLRWTP ELHRSFVHAV DLLGGQYKAT PKLVLKIMDV  60
KGLTISHVKS HLQMYRGSRP TLLGRLEESS SSSSRRRRRQ DNGDQLHDNL SEHARNDCLF  120
GFHSFNFRRE QNLGTDNDDD DFLNIMNMAR TKTFAGNGES IKFQPHQFFE AQSMKSNMGN  180
EHEEEELSLS LSLNHPPNHQ QRWRSNTSSS LSEASEAVSS PFTSRDCFAS SKIDLNLNLS  240
FSSLFRS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00081714001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ6304860.0AJ630486.1 Arabidopsis thaliana mRNA for hypothetical protein, clone At1g14600.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148839.11e-156PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
SwissprotQ700D91e-115MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A078I5B90.0A0A078I5B9_BRANA; BnaA06g09420D protein
STRINGfgenesh2_kg.1__1592__AT1G14600.11e-122(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-100G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]